PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G2937
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 314aa    MW: 35700 Da    PI: 8.5982
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G2937genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.29e-092974346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +W++eE + + +a +++ ++   +W ++a++++ g+t ++++  ++ 
      Gh_A11G2937 29 NWSAEENKCFENALALYDTDtpdRWFKVAAMVP-GKTVEDVIKQYRE 74
                     8********************************.*******999986 PP

2Myb_DNA-binding44.92.6e-14137181347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
      Gh_A11G2937 137 PWTEEEHRQFLMGLKKYGKGDWRNISRNFVMTRTPTQVASHAQKY 181
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.4112580IPR017884SANT domain
SMARTSM007177.1E-112678IPR001005SANT/Myb domain
SuperFamilySSF466894.26E-112882IPR009057Homeodomain-like
PfamPF002497.7E-82974IPR001005SANT/Myb domain
CDDcd001677.51E-82975No hitNo description
PROSITE profilePS5129421.447130186IPR017930Myb domain
SuperFamilySSF466896.88E-17132185IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-17133185IPR006447Myb domain, plants
SMARTSM007173.8E-13134184IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-12134181IPR009057Homeodomain-like
PfamPF002492.1E-12137181IPR001005SANT/Myb domain
CDDcd001677.15E-11137182No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MMNRGLEVLS QTSYLQTWNW LFQESKGTNW SAEENKCFEN ALALYDTDTP DRWFKVAAMV  60
PGKTVEDVIK QYRELEEDVS DIEAGLIPIP GYTTDSFRLE WVNDSQGFDG IRNYYTPGGK  120
RGSGSRPSDH ERKKGVPWTE EEHRQFLMGL KKYGKGDWRN ISRNFVMTRT PTQVASHAQK  180
YFIRQLTGGK DKKRTSIHDI TTVNIPDTPP SSPDHSKPLS PNNSSAVIQS QQQSKVPSIT  240
TKELFDFEWK QHNEGVAAMV FNQTSTGNAL LSPLCGISSY GTKLEEKKLP RGTLPRSQFG  300
SYNTLFQMQS MQHQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-172794875RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.7610.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012435251.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-111DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0B0NH480.0A0A0B0NH48_G
STRINGPOPTR_0006s09860.11e-156(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-119MYB family protein